PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015037t1
Common NameTCM_015037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 979aa    MW: 109375 Da    PI: 7.5407
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015037t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix30.78.3e-102142791682
          trihelix  16 emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82 
                       ++  ++ rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e+++++e++   +yf
  Thecc1EG015037t1 214 DVAVQSTRGKTRADKDKEVAEFLNRHGINRDAKTAGTKWDNMLGEFRKVYEWERGGEKEQV-GKSYF 279
                       556677889999*******************************************976665.44455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001802.35E-13830965No hitNo description
SuperFamilySSF561122.52E-15830964IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.102.8E-6833964No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    Send to blast
MGDTKGDTTK KPTPQQTQQL SSSPKESLEE SSESRQKHLQ QQSAVVVTGA PFISAPLYVP  60
IGATSSPFEQ QFESVNPKRP RYNSGQWKLL PSPSSLQTQA QMAIITSESS PSPTTNPKNP  120
QTQAHTTAAS SSDTASSPPH SPLPSTTSGQ ETNKPEGEQF HHQFRKGKYV SPVWKPNEML  180
WLARAWRIQY QGGSDASGSS RIGHQETSHV AGSDVAVQST RGKTRADKDK EVAEFLNRHG  240
INRDAKTAGT KWDNMLGEFR KVYEWERGGE KEQVGKSYFR LSPYERKLHR LPASFDEEVF  300
EELSQFMGPR MRTSQSRASA IASGDDGRPV ISGSRALPPP PPFKEDELPP SVRTKQLVTT  360
SGGDAFFHGT RGSLLGFDNS LDVSVGLPSS SSKEPRRIGK IRMAWEESVS LWAEEGEHHR  420
GRVRLQGSSF LNADELTFFD DTMVACTIEA FEDGPLKGFS VDRFVNGQQV KVFGRRKSST  480
ASASSGFIDR AQLPFAEPPI RPMPPLEFQD PTDYYVGCLR VPPTTLPSLF ELSWHLQEPP  540
PEEYRFHLRK DVYRDLPPGK EVLFTTSNEL LDCRAIIYDI LSPIIRTNPS LSAATAASRD  600
SFIGLWDDCI NRVVSKFCSV EMVIIRKPSS SSSTEPLQDQ WPNVTGFVRN FCLWRGEETD  660
QLRESQLDPP SSIVEKLLWT YMDLPYILGY YAVGYMVTFC ALSRSQDRII RTDLYSVDLS  720
SPSERLKALA PCCRIAGLLP LLADRCFSNV NNIGSYKQFP FSDFERIDMG NGNIMEMTPN  780
TVIRSFSSRK KWAAVKEIYD ILDHRIPHAE FICRASEKDL TLVFKPRGCK FKPVNCDQLV  840
EALKYVTKAL VALHDLCFMH RDLSWDKVLR RSDRENEWFV CGFDEAVGAP QIYPQAVAGA  900
EARGRHAPEM GRGLHGVKVD VWGVGHLVKT CGLTNVPKML RELQNRCLDQ NPEQRPTAAD  960
CYHHLLQVQS ASSSGAPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038523.10.0Kinase superfamily protein isoform 1
TrEMBLA0A061G7K80.0A0A061G7K8_THECC; Kinase superfamily protein isoform 1
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.11e-07Trihelix family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]